DPCstruct | MC2122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 251 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 15.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1UK92 | 90-349 | FAYNKIFEHSAFMDDELKLIHEALELSGGKEQIAYYADLVGSGLPQLLNNLGGQKIREELLTIIRESYCFDKIYPLVVNVFQSRFHK… |
| A0A3B0MBH1 | 2-232 | AEEGRDATLNDPAVPDTGTGRAGWEMEVARIYDDDRMHDAFATALDDGLDPDVRAEALAFAQSDLGRRVLQLEVSARRALLTQEIDD… |
| A0A1F9CNB0 | 314-571 | None |
| A0A523NIT5 | 62-325 | None |
| A0A1Y5GHQ9 | 4-267 | None |
| A0A3M8G0U5 | 154-402 | None |
| A0A7C8DQZ3 | 29-290 | None |
| A0A661G4T0 | 183-445 | None |
| A0A1M6MW16 | 18-280 | None |
| A0A848ZKF9 | 99-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.