DPCstruct | MC21216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 297 ± 16 aa |
| Standard deviation of domain lengths | 16.11 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850BAI2 | 240-531 | RGESETASLAPGPAAGSLPPVPRAPAPPPAPRARPREIVKLLWHDAKALPRVRKHPRWRVLLAELELRLLEQGDLDDQEEGGADDAD… |
| A0A2L0EY86 | 3-260 | ETLELVWIDPKSTARIRKRPPWQRLVDDAGRDPPAGPELPGQTVPAEDRHDVFLILARSAATDGHGVAAALSDAVREDGKFAPPLVL… |
| A0A150TEG1 | 1-298 | None |
| A0A850B3L7 | 45-372 | None |
| A0A7Y5NPG5 | 256-555 | None |
| A0A849ZG89 | 352-647 | None |
| A0A6N7PY12 | 499-791 | None |
| A0A849Z859 | 264-561 | None |
| A0A849Z2Z2 | 143-445 | None |
| A0A6N7PZC3 | 378-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.