DPCstruct | MC21213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 171 ± 18 aa |
| Standard deviation of domain lengths | 18.32 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 93.81 |
| Assigned Pfam label(s) | PF07627- PF07631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3JSY5 | 60-208 | AKKLLDDPRAEQVLASFHGQLLDVSSYGKGVKSTEVYPGFTEELRPMFAQEAGLFFANVMGAERGGLRELLTSPVTYVNDKLAPIYG… |
| A0A150U300 | 1-143 | MLLAGAAGSSLHQWLGLSELRKAQKDRELFPAYGEAMASAMLNESARFADHVVRQGDGLLRTLLSADYTFPEDPLFDLYELEPPDGF… |
| A0A2T6FJM5 | 415-588 | None |
| B4D2Z2 | 2-188 | None |
| B4D7Q6 | 323-515 | None |
| A0A4Q6FRM4 | 282-457 | None |
| A0A1P8WEV3 | 803-991 | None |
| A0A349VIX0 | 375-507 | None |
| A0A800JJF4 | 2-163 | None |
| A0A517SX76 | 589-736 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.