DPCstruct | MC21212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 184 ± 8 aa |
| Standard deviation of domain lengths | 7.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 34.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1H256 | 395-577 | SALNQVRTNEVAFGKPWELREFRIAASGPRAHMLLQAPVAQTPDEETINGGSVLARFIDANAERIRESKHVVPREFPAGRRFQGGAA… |
| A0A1H7KV49 | 664-841 | GSAIHHVRTNEAALSTLWEMRDFSLTAEGLKPAATALTPDFGFNNSNALGNFIRANEDAILAEQHQVPAVFSGAPFLAAGVRVPDET… |
| A0A3A8HSC6 | 807-981 | None |
| A0A538PVG4 | 173-355 | None |
| A0A7C8CL36 | 113-311 | None |
| A4B8V3 | 503-693 | None |
| A0A5C7X8C3 | 468-644 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.