DPCstruct | MC21210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 19.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.15 |
| Pfam Score | 87.72 |
| Assigned Pfam label(s) | CL0707- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7CES2 | 3-90 | RVLVCQTVFNKLVKAVEAGEASKAVDIIDATCEKMTGKEKKVCSNIGALPNSPTRIVQQVARYITSGLPPFKICEKLAQTDPQICEYT |
| A0A5G2R1P7 | 23-162 | RAQGQEAGGRPGADCEVCKEFLSRFYNSLIARGVNFSVDTIEKELISLCLDVKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPV… |
| A0A3Q3FHA3 | 3-106 | None |
| A0A3Q3FHC4 | 3-131 | None |
| A0A1B0B493 | 7-123 | None |
| A0A0P1AMH9 | 3-160 | None |
| B7FQL4 | 104-240 | None |
| A0A830HG94 | 9-180 | None |
| A0A7R8CQG4 | 13-128 | None |
| A0A7R8CQ90 | 9-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.