DPCstruct | MC2121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9L404 | 473-557 | VVGRSVRRVTFSDGSFAHAGGKRWIEKDAAGTVKYTFNETGRDDWSVYLQDTAGRGLLQIDIHRKTICWTPTTGKKIDLYRMTGW |
| A0A848V461 | 25-127 | STSLPAFAQSVDTSPQDLSNVKRVNFYSGSFARTSDNSWDEFDRFGSYRFSFQEVRRGASSLYLRNDQHDVDIELNLRDNKIYGKWP… |
| A0A518CUF8 | 210-309 | None |
| A0A3E1EI82 | 184-277 | None |
| A0A0J8H0H4 | 17-116 | None |
| A0A0N1HSR8 | 33-148 | None |
| A0A1H9BE05 | 28-124 | None |
| A0A1Y6BWS0 | 219-305 | None |
| A0A7L4ZQR2 | 4-105 | None |
| A0A177R294 | 77-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.