DPCstruct | MC21207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 144 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9JUM5 | 145-273 | REEFTEAEIKEANYVFEWCQADAYMPIYHDCKCLASEFVAKRKELGRLPSRDSILSTLKGVCLNGTQMAGFLYKDCISKPALLPLHL… |
| A0A2M8CVL7 | 90-218 | SPEDQAQVIEESNKVYEYCNKRELFASFHDCECVAGKFFDARLLNPDPTMSIITIGDRVAKECPNIPGVAGFAYEECHKSYGFKLKV… |
| A0A4Q3ZLN5 | 21-166 | None |
| A0A2G2EPP3 | 39-193 | None |
| A0A7C7WNX3 | 1-144 | None |
| G2KPZ9 | 75-236 | None |
| A0A7G6PZ15 | 296-439 | None |
| A0A2A5BXG7 | 804-948 | None |
| A0A3C0Q3J4 | 19-165 | None |
| A0A2U1CKS0 | 108-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.