DPCstruct | MC21204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 197 ± 45 aa |
| Standard deviation of domain lengths | 44.85 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7NJG7 | 138-293 | FAARRYYLEYSDSLNDFIDGFETCFPKLYFNLHISSTMKVFRPLRQFTNEIIKHLSALNDYGQSLFTQYASSGQVIVLSYLGATCGI… |
| A0A4U3FMU1 | 29-206 | LEEVAEALRAQLEDTKRSFNTYSEHIEAEKVEDVDLESLDVAAAYRLARKEAPDNLVFLSEADDSVAAFSSYKSPRRLYEALTALSE… |
| A0A066YYA2 | 165-345 | None |
| A0A353G6H9 | 131-374 | None |
| A0A2N5B729 | 131-360 | None |
| M1YZH6 | 8-227 | None |
| A0A7G5LRZ7 | 272-506 | None |
| A0A6I7MFS2 | 2-106 | None |
| A0A2E6JYA5 | 71-216 | None |
| A0A3D3NRK3 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.