DPCstruct | MC2120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 298 ± 54 aa |
| Standard deviation of domain lengths | 54.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848V048 | 39-305 | LAAQVQSESQKLSDWFDVRHQDEIARSPMTAATLGLSHDNSNLDDTSRLALEETIALHTAWLEELDLGFEINRLDSESQFYYSLFKN… |
| A0A3N5HCK8 | 2-252 | RSLAEEHFEGMLRLDPLLATMVGDRRYDDRLPEDLTDGGREEKRQLALRTRASLEAIPRTELRGEDVLTWAVLDDLTRTTLEELPLD… |
| A0A2B4S3G6 | 2-408 | None |
| A0A5C6ANG8 | 15-327 | None |
| A0A2K8UEU2 | 2-293 | None |
| A0A7Y5VFL4 | 1-213 | None |
| A0A179HU15 | 367-809 | None |
| M6VN05 | 14-239 | None |
| A0A7R8H7I7 | 13-264 | None |
| A0A7C1D5K0 | 23-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.