DPCstruct | MC212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 354 |
|---|---|
| Mean domain length (aa) | 286 ± 67 aa |
| Standard deviation of domain lengths | 67.10 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 18.19 |
| Pfam Score | 98.92 |
| Assigned Pfam label(s) | CL0192- PF03747- CL0145- PF20118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F7ZZV0 | 2-206 | RVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSKHFLKQLLGHMEELEGDAQSVLDARELGMEEHPY… |
| A0A1F4U670 | 23-279 | LRAGQVTDDTILTQATVDSLIRRRSLDPADIALNLGRAFKKNKDLGRGFGQATITALTRILKRRPWNMVGDNNSLGNGAAMRIAPIA… |
| A0A7K2AVX2 | 20-387 | None |
| A0A1Q9CD62 | 228-510 | None |
| B0EJU1 | 1-188 | None |
| A0A3N4L158 | 3-322 | None |
| A0A5P2CTB4 | 28-334 | None |
| A0A1G5ATA1 | 1-276 | None |
| K2SJA6 | 2-222 | None |
| A0A0G4HI97 | 63-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.