DPCstruct | MC21197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 489 ± 44 aa |
| Standard deviation of domain lengths | 43.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5LHH1 | 1-429 | MYSCIKSFMDNDKENGLLLLDMPTGFGKTYSVIKYIAEFIKENSDTGKKIFFITTLKKNLPVEELKKRLDDMELLHLFEERVIELKS… |
| A0A0D1ENN9 | 4-490 | LLETYLEMAGPETCQSKSGFLAIIDAPTGLGKTYQATELQLEHLCTDSKITLIYSTNLRVNVKEAYEALLDRIDGNASLNASQREQL… |
| A0A3E0GZX3 | 25-528 | None |
| A0A2H1XMB8 | 2-515 | None |
| A0A2E7E5N7 | 1-505 | None |
| A0A4Q7DWD0 | 14-562 | None |
| A0A1W9W3G5 | 23-402 | None |
| A0A374NMR0 | 1-503 | None |
| A0A1I2JYZ8 | 58-568 | None |
| A0A4Q5LR22 | 5-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.