DPCstruct | MC21196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 4.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212RZA3 | 10-67 | LDMPIFANTGVYIDDVADVMAIADGCVIGTHFKQDGDTWQPADGQRGKRFMDKVETLR |
| A0A7C5SQ98 | 9-71 | EALPEVPVLANTGVDHANVAAVLRTADGCIVGTALKEDGKTFNPVDPERARAFMERAREARGE |
| A0A7C4NJ22 | 1-66 | None |
| A0A017HS67 | 223-279 | None |
| A0A139WJQ3 | 238-296 | None |
| A0A7J2IRZ5 | 135-195 | None |
| A0A1W9V270 | 112-172 | None |
| A0A7C5KEP8 | 85-136 | None |
| X6HR44 | 131-186 | None |
| A0A7R9EXZ8 | 63-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.