DPCstruct | MC21195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 162 ± 22 aa |
| Standard deviation of domain lengths | 21.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9C3R5 | 6-167 | RFLVTLVAPVFVLVGLHCGIVMPDIDQRTDLLLHRSIITHSPLIPLIVVLLALRIGLGLYTFAMGVSIGFAVHHAFDLFPTGWTGYA… |
| A0A212RT32 | 5-160 | TAGQSPPLFLLGLLIGIWLPDIDLAIPYLPHRSGLTHSILPGLILLFIGQPRLAAGILAATAIHLSADMFPVSWRGSALIYLPLTGG… |
| A0A0H5D0Y6 | 16-211 | None |
| A0A142B9I9 | 14-183 | None |
| A0A2E5JVL3 | 2-168 | None |
| A0A497AGC5 | 3-134 | None |
| S9QUI5 | 17-153 | None |
| D6LG75 | 1-119 | None |
| A0A2H9T617 | 63-229 | None |
| A0A2G6E1N2 | 3-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.