DPCstruct | MC21188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 180 ± 45 aa |
| Standard deviation of domain lengths | 45.16 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6TF00 | 8-168 | LRVIRRLRPYRSPQDIGLNAWKLQAYLITHVLYVLSEWGARPLSPTTLHYEYDFISEALTLCMGSIDDPELCGEVVQCLRIFEAGSE… |
| A0A0H5R4B1 | 381-517 | IRPYKSLEQIGLASFKAQSYFITHLLFVMSNWGEYRLDSILFAPEITFIISNIPVVIRLGDPEIIGEYIQCLRIMGADESDVHVQRG… |
| F0YJL6 | 555-700 | None |
| K3WUP0 | 254-508 | None |
| A0A7S3AHP5 | 4-157 | None |
| A0A6V1SG28 | 240-403 | None |
| A0A196SDP3 | 168-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.