DPCstruct | MC21186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 91 ± 16 aa |
| Standard deviation of domain lengths | 16.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | PF10601- CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6T8D0 | 5-87 | AAYPAPMAQPFFEHEPVIVSCPNCGSVGQTRVWHRIGLGSLVAMLLIAALFFPLFWLPLVCRSCQSAQHHCPTCNYKVGEKTF |
| J9IA61 | 300-372 | GKRVPMQFKCPNCKTDREQRTKLKYECTGNQWCACIVFCFFACYPLCCVPFCIKRCYNVKHMCPQCYYQVGES |
| A0A6A5DZR6 | 243-336 | None |
| A0A6P4EVW9 | 5-84 | None |
| A0A6S7FLN7 | 20-100 | None |
| A0A179IEZ4 | 231-349 | None |
| A0A2B4SN90 | 350-445 | None |
| A0A2K0WDX1 | 35-147 | None |
| A0A0V0QNR7 | 40-127 | None |
| A0A4U5LP99 | 41-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.