DPCstruct | MC2118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 5.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8SW19 | 2-66 | AQFQDVEVVRLRQDLPDKGLKAGKIGTVVMVYPEQPQAYEVEFANEKGVTIALVTLLEEEIESAE |
| A0A316SMQ9 | 10-73 | VEPMDAVILLNDNYANAGLKKGFIGVVVDNLIKTHNIILADFDNPYTGQSIAVLAEIKKEDFRV |
| A0A534K528 | 114-180 | None |
| A0A6B1HSE6 | 9-79 | None |
| A0A845PTF0 | 2-68 | None |
| A0A856ME60 | 4-72 | None |
| A0A3P8JZC9 | 1-63 | None |
| A0A351LCT7 | 75-150 | None |
| A0A3L7WZB3 | 3-69 | None |
| A0A832G7G0 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.