DPCstruct | MC21179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 201 |
|---|---|
| Mean domain length (aa) | 123 ± 28 aa |
| Standard deviation of domain lengths | 28.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.04 |
| Pfam Score | 78.53 |
| Assigned Pfam label(s) | PF03449- CL0487- CL0265- PF14760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7U0U4 | 13-100 | RRFRSSDRVGVGALVDVRVEDEEGEGERTLFLLPVGAGVALPGPGGDGFITVVTPGSPVGKALSGAQIDDCFEVVVDGRDREWTVVDI |
| A0A1J5KML8 | 12-122 | QGIDTEVTMAGDEATKGALLSEKDMYEEISLDDKSGKVQIGSVVRLNYNGKINTYFLAPSGMGNIMKVGNEAVVVISVFSTLGDAIL… |
| A0A4Q3MJ26 | 1024-1109 | None |
| A0A645IYH1 | 1-67 | None |
| A0A3N5XIH4 | 873-1024 | None |
| D4KVF5 | 223-374 | None |
| A0A847AT02 | 7-88 | None |
| A0A399YZ95 | 15-125 | None |
| A0A511N8K0 | 12-138 | None |
| H8H1V5 | 354-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.