DPCstruct | MC21178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849SYS0 | 209-298 | ASKIIETLTETPPPAYDQMGRGLVYNCKDKYWACVDRASYVICNKNLKYNESVGKTKECVVQAIYATNDDCAKIQKYNVSVSQSTDF… |
| A0A1J5KMR2 | 8-118 | LIYLSIFLSLSVNAAKEAIFDVAIYKKFMEEVYITNEFRRGEFLIYNCDLKHFACVNKESFKLCANKRRNSKEFKQEGQSCRPIRTF… |
| A0A496XRY3 | 169-276 | None |
| A0A2E4D6A0 | 433-564 | None |
| A0A1F3T2C4 | 14-149 | None |
| E1WZ28 | 30-140 | None |
| T0RH38 | 13-90 | None |
| A0A2G8HRM0 | 97-199 | None |
| A0A8B3SPT2 | 370-491 | None |
| A0A1F3ST60 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.