DPCstruct | MC21177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 173 ± 36 aa |
| Standard deviation of domain lengths | 35.73 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 12.94 |
| Pfam Score | 98.28 |
| Assigned Pfam label(s) | PF01052- CL0355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1U4P4 | 4-128 | LISSFIETIQSSINIKPTQISEGVRQGFVSSIKLQNQEIFFCCELTFLKLLASEMLFEDQPSQEILLDLSKELANLVVGHAKVLYSK… |
| A0A1J5KFL6 | 124-290 | NDVDVSFIKSFVNATVRTVFVQAKTLAKRESLGMIDKEKNLLKGDISGVVNVEATQYPYVILLSFPSSTFINLINIMTGESYTEITD… |
| A0A258RHR0 | 36-197 | None |
| A0A256Z6J6 | 13-187 | None |
| A0A1F3XYN1 | 7-137 | None |
| A0A7Y4ZMN4 | 142-294 | None |
| A0A2N2ARF6 | 42-232 | None |
| A0A519KMI1 | 92-282 | None |
| A0A7C3PXN1 | 1-279 | None |
| A0A1Y6B6F1 | 8-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.