DPCstruct | MC21176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A345CUG6 | 6-92 | DKGKVFRGTNVERMATGRAPVGYDGNAVNLHHMLQTQNGPIAEMSQTFHKTNHGIIHINPNTIPSGIDRAAFDAWRKQYWISRAGGF |
| A0A454W787 | 6-94 | FSPADKYGRSNLKRMQQGLAPMGPDGKPLNLHHMLQTQDGPIAEVTHSMHFGNYNQLHWKAGTKIPSGIDRDAFNAWKSQYWKDRAA… |
| B9NWZ1 | 122-226 | None |
| A0A556QWZ2 | 168-283 | None |
| A0A1I1N030 | 300-416 | None |
| N1NIC9 | 913-1039 | None |
| A0A413R8L8 | 64-154 | None |
| A0A1V1VG98 | 32-120 | None |
| A0A1N7BUP4 | 123-241 | None |
| A0A6N2YA42 | 653-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.