DPCstruct | MC21170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 137 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.74 |
| Pfam Score | 88.24 |
| Assigned Pfam label(s) | CL0023- CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0M3I5 | 2-139 | QIAVLDRERCHPKRCHHECQYYCPPVRSGTPTIEFPVPDEQPVINEPLCIGCGICVHRCPFGAIKIIGLPDELNSEITHQYGLNSFR… |
| A0A2G2ZN09 | 2-135 | SNQRSTHISIVSADKCKPKKCRQECKKIFPVVRTSKLCIEVTAASKISFILEELHFGCGICVKKCPFEAIQITNLLKDLDKDTTHRS… |
| A0A816LTH1 | 1-149 | None |
| A0A818GLJ3 | 11-155 | None |
| U6KZ54 | 11-155 | None |
| A0A820TGL9 | 760-871 | None |
| A0A0B3AAA7 | 30-147 | None |
| T1GMV0 | 1-153 | None |
| A0A803LI74 | 31-174 | None |
| A0A3Q3CP02 | 3-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.