DPCstruct | MC2117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 54 ± 5 aa |
| Standard deviation of domain lengths | 5.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 63.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7T604 | 2-52 | RPDLKVGICGEHGGDPASVEFCHRVGMNYVSCSPFRIPVARLAAARAQLST |
| A0A2S8SVA6 | 128-184 | VDDARKVNPNIKLGICGEQGGDPDSVKFCAKLGLTYVSCSPKRVPVARLAAAQAAID |
| A0A7V4JHR8 | 2-55 | None |
| A0A845QJ20 | 623-682 | None |
| A0A7J0GDV1 | 281-335 | None |
| K2DAF0 | 867-926 | None |
| A0A1D6FQF9 | 578-630 | None |
| A0A1D6FQF4 | 761-813 | None |
| A0A1D6FQH6 | 295-347 | None |
| A0A1V4VPS8 | 4-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.