DPCstruct | MC21168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 204 ± 26 aa |
| Standard deviation of domain lengths | 26.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9T8D6 | 6-210 | ISDTCIAMEEWVDHPHAVTALSNILPCVDQSTTNKTLVQSKEVINDIVNVVNTYIYTFANANPSPTEFNYYNQSGPFMPPLCYPFDS… |
| A0A2G2ZAY9 | 2-181 | DEWIQNPTARTASDKILPCVDYATAQETLTKSKEVRYNLVDIVNQVITNVSNINFSPNVDPFYYNQSGPVPPILCNLFNLDLTSHNC… |
| A0A7N0TKZ6 | 77-298 | None |
| A0A4S4EJR4 | 176-416 | None |
| A0A251SW04 | 11-230 | None |
| A0A4S4DHL1 | 120-323 | None |
| A0A1Z5RIC8 | 149-363 | None |
| A0A1R3K323 | 228-407 | None |
| A0A368QWI3 | 11-208 | None |
| A0A2C9W3L2 | 17-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.