DPCstruct | MC21166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 96 ± 5 aa |
| Standard deviation of domain lengths | 4.70 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.60 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF04990- PF04983- PF04997- PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812XVU8 | 68-163 | VTSFTQIFWDPDPEHTLVEEDQEWVSLYYELPDEDENPQRCGPWLLRIQLSNKVMTDKKLTVREVGERILSDFQNDLDCIFTDDNAE… |
| A0A2G2Z8N4 | 4-95 | MSTLIEEDAEFIKLYYEMPDEEIEPDKISPWLLRIELNHEIMVDKKLSMADIAEKINLEFDDDLTYIFNDDNVEKLILQIRIMNDEA… |
| A0A820RSE4 | 68-161 | None |
| A0A1J8Q0N0 | 2-95 | None |
| A0A819MJ77 | 376-475 | None |
| P14248 | 1487-1583 | None |
| A0A2G2WQ60 | 53-136 | None |
| A0A1E5V2Y0 | 155-256 | None |
| A0A3M0LFQ1 | 1008-1107 | None |
| A0A3L6Q0B5 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.