DPCstruct | MC21165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 230 ± 39 aa |
| Standard deviation of domain lengths | 38.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 67.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9EKN0 | 1-167 | MLHLWIPLGVLLVSSSCVNEQSCDMLLRYASTGQVLESNAVQIKTNNHANNDGFSTSCRDVSEQCALSGAYLIFGWLDIVEDMSSMI… |
| A0A2G2Z350 | 11-216 | SLAFWLKEFQDMYIGHSSKLSESFAPDEEQAPSVSFQKNTLFRRITIGILFASLNHISDTECELLLHYGATGTFVHFTGGQLGTQNR… |
| A0A6P6T0V3 | 449-651 | None |
| A0A7J0FJV4 | 316-510 | None |
| A0A2P5BNU5 | 99-355 | None |
| A0A7G2EU95 | 1028-1271 | None |
| A0A6A2YBC1 | 526-783 | None |
| A0A446RHC1 | 592-772 | None |
| A0A843XK65 | 83-346 | None |
| A0A314ZCC4 | 15-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.