DPCstruct | MC21163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 225 ± 23 aa |
| Standard deviation of domain lengths | 22.94 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8D6S6 | 87-325 | SEVVRAIGELRGSESFAGKKEADEILGKAIRAMGPERVLSILPLNLIKPKAGQPGRAWMLPILRDYVSNTNLQHFRTELEPLSQAML… |
| A0A2G2Z1G9 | 1-217 | MLQSLVDMQKLPDEDFPYRRQLHECVGSAVGAMGPESFLALLPLKLDIEDLSKSNLWLFRILKQNIIGAHLSFFTNSIMSMVGAMKQ… |
| A0A0B0N7K0 | 302-555 | None |
| A0A059A2S0 | 173-390 | None |
| A0A835MWY4 | 168-417 | None |
| A0A7J0FI01 | 4-230 | None |
| A0A0M0K010 | 192-431 | None |
| A0A2G3BZ66 | 36-290 | None |
| A0A2U1Q546 | 249-422 | None |
| A0A3P7J9W4 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.