DPCstruct | MC21159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 87 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8JWI2 | 29-113 | ADIHEQRRERGFVCFTDHYHYGSSSGLSSKKAAQAAAIKSWADFVNFEYGGAWTSWARSGSKSIKCDHAGTGGAWSCDVNSRPCR |
| A0A5J4DYW3 | 11-101 | GLMLYLLLAVQAEAAEDKTKSCKDKITAVGRPNRIQSLSSMSAVIQWTQRANELGKQYGQWHNALRTDLSCKLMQRSGYYVCYASAK… |
| A0A037UVF5 | 15-103 | None |
| A0A6N6T2V5 | 144-241 | None |
| A0A857CD04 | 21-107 | None |
| A0A125NWA5 | 1-81 | None |
| A0A109BLP4 | 73-154 | None |
| A0A433A8W8 | 148-243 | None |
| A0A4Q5RZ81 | 13-116 | None |
| A0A433B8V7 | 3-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.