DPCstruct | MC21157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843A2K7 | 1-85 | MWKIGDFHRKEYSDKGIHEPEHILKYMEKTNWYTLKQDSKKNFTLVLAVSESARFIKIFFEGFFSNYPRKVDIQEEFMKIRINLL |
| A0A075W979 | 94-173 | ENVGYELGVEMKLKGFGLDELLEHMRIKNLLNYSREGGIYILTLVSRSATNMVMRMLRGAFRAMQIEAEVIPGVRKVVIV |
| A0A7J9RRF8 | 9-85 | None |
| A0A256Y0N7 | 97-179 | None |
| A0A346PNL5 | 167-266 | None |
| A0A7C4GTY5 | 103-191 | None |
| A0A7J3TIL7 | 42-136 | None |
| A0A133VDS9 | 99-182 | None |
| A0A5C9F1R7 | 38-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.