DPCstruct | MC21152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 127 ± 20 aa |
| Standard deviation of domain lengths | 19.68 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0378 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0FAK6 | 9-126 | PIETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFPCTTKQDLRDNYPFDTFAVPMEQVVRIHASSG… |
| A0A842XQI9 | 3-116 | NQWKGYASLKEEQDASLWKLVSFAYENVPYYHRLFKGLGLKPEDVKKVEDLQKLPVLTKEIIKRNWDDLRPVNLRDIRYADKATGGS… |
| A0A534ZZP5 | 272-426 | None |
| A0A7U9G5K4 | 41-147 | None |
| A0A521YI95 | 129-248 | None |
| W0BA51 | 2-141 | None |
| A0A1I5Y6F4 | 12-161 | None |
| A0A4P6GVW3 | 55-185 | None |
| A0A0K8J7K0 | 10-122 | None |
| A0A4U9HMI4 | 12-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.