DPCstruct | MC2115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 112 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316WQT3 | 2-78 | DSFVETRQHLYDIYNDRLGMSFYLGNHFEGHREVVEKMRNSDLENVRLSVIDGDKRSCSIFSSEDFSVILGIIFYDN |
| A0A1E5PK92 | 8-112 | ACKAARDAIAAGGEVMLYDGQPPQWMVLGIAATRLKRSLKIGLTTLGLDETVEILRARHCDEQLRTGNIVAADRSWFFTLYFDATGT… |
| A0A1C5CTE8 | 107-222 | None |
| A0A4V2IEP6 | 1-120 | None |
| A0A7H1B8L1 | 51-165 | None |
| A0A653ZLU9 | 7-120 | None |
| A0A1Q7BNR9 | 4-107 | None |
| A0A4R5HF53 | 5-122 | None |
| A0A2W1RDV7 | 119-238 | None |
| A0A2Y9TY12 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.