DPCstruct | MC2114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 165 ± 11 aa |
| Standard deviation of domain lengths | 10.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08847 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5PH95 | 122-292 | VCKSDGPAAGRTEVEHLEVASELLASCDIYPFVVRYSHHALGSGPDEIVRLRQMRGSLVISFDVPQHDPREVWEVPEVRAYVTKLAD… |
| A0A369QSR5 | 10-161 | ELDPIVIVISRDEVEAGDIQPSLSALQSCIASIDMIRDRFERLDVAFHGYNDDSREVFEIPEVREFVHRLDGEFPFWLFFLSKSYLG… |
| A0A6B1TIL5 | 174-335 | None |
| A0A5C8AUB7 | 2-153 | None |
| A0A1E3C136 | 15-170 | None |
| W4QMG0 | 2-141 | None |
| G2DW53 | 31-208 | None |
| A0A4Y7IYF5 | 199-374 | None |
| A0A443PJY0 | 132-285 | None |
| A0A7V7MQF8 | 142-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.