DPCstruct | MC21137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 100 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 73.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9CXS8 | 9-110 | WLLSNFDSQEDIAFPNDPRVPIKVDDDLKELFRSIELPRDMLDIEKDLQKNGMKPATNTAKRRAAAQVQGITSKPKPRQKNKEFSKK… |
| A0A0A9AH11 | 1-92 | MVYPNDPRSKIKVDHDLKQLYREIELPRDMLDIEKELRKIGEPPATNTAKRRAWAQIHGAPPKPKAKKKQRGISRRTKLTNCHLPEL… |
| A0A453DQZ7 | 109-209 | None |
| A0A2K2C6P7 | 14-112 | None |
| A0A2R6Q8B5 | 287-389 | None |
| A0A7J6DSW5 | 141-243 | None |
| V4LXB8 | 135-232 | None |
| A0A5N5P1P0 | 279-382 | None |
| A0A6A2ZEN4 | 199-288 | None |
| A0A7N0TD83 | 75-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.