DPCstruct | MC21133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 230 ± 38 aa |
| Standard deviation of domain lengths | 37.75 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3E0D1 | 1-236 | MERQDLVIAGIGNASGGKYNLVKIAGNGSLNGEIDCIDLIIQGNAKIHGNVKAKVTHVSGTARLQGALRSEIMKIQGNASIDGDVEC… |
| A0A3D4QT81 | 2-211 | KKTYVDGIGSLYGGSYDEVTVSGIGKLKGDLKANKLNVDGMFKSKGRIEADSFINDGMSRIYGDVKVGELRIDGMFKARCSKIEADS… |
| A0A1F9ZFL3 | 109-318 | None |
| A0A5B9DEZ9 | 7-260 | None |
| A0A534IKP4 | 135-345 | None |
| A0A497FKT2 | 41-257 | None |
| A0A1S8THK3 | 2-219 | None |
| A0A534JQI6 | 165-392 | None |
| A0A080N1U6 | 1-213 | None |
| A0A524F0F3 | 59-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.