DPCstruct | MC21130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B8RRP1 | 64-165 | IRMKDGKEIYDSDPGAFQGTFLFGSFEVVATDPAGKELAKLGLNDVFDGGEMNFRKELPFEIQFDDYNEDGESDFTVGQWGGSNGNF… |
| A0A3D4LJQ2 | 1-128 | MVTLSNNDLFPVNGENQYLKLKMIEGEYYEDLNPGPYMGANWKGNFVLELADEAGNVISQTDLNKVFKEPLIFNSSFEIQFDDYNDD… |
| A0A1I0DXV8 | 158-277 | None |
| A0A264DNW0 | 131-249 | None |
| A0A480BFD5 | 2-104 | None |
| A0A7C6RLS9 | 44-165 | None |
| A0A1K1MH55 | 49-165 | None |
| A0A7C1DK46 | 48-156 | None |
| A0A3A1UW67 | 56-176 | None |
| A0A4R1ZP44 | 250-370 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.