DPCstruct | MC2113
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 300 ± 28 aa |
| Standard deviation of domain lengths | 27.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5P1C9 | 2-331 | ELWLKHLDHNRPGAERAELPLILEIALAQGFKFAANRRRRHPNTNEETREFMVQQAEILLARSRYWYSQLTIIHALCLWELPDSPGR… |
| A0A1C4V6Z6 | 55-370 | AEWLGELAAHEPGHRSMSITSEMALAQGFRLAANMRRLPVGRPHWDRSFLIEKAEFALRNSRFWYSHLALIQALTLLSLPDDPLEPV… |
| A0A7W7LEA5 | 322-640 | None |
| A0A2A3I0J0 | 2-265 | None |
| A0A0D0PRE4 | 1-296 | None |
| A0A4Q7WIK3 | 208-518 | None |
| A0A4V2GCX5 | 6-244 | None |
| A0A0D0XAN4 | 762-1074 | None |
| A0A2P9F8V9 | 890-1209 | None |
| A0A1D8G858 | 310-581 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.