DPCstruct | MC21129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A641W7D3 | 1-88 | ALTCVRKRLFAVDGNFNEKGFLQLGFAGHQTGLADWYSNNGSMYITSEVFLPLGLPASHSFWTAKPQDWTSKKAWSGHEFPKDHAIHY |
| A0A7C4IDQ4 | 72-169 | PASLTPAQVRCALGAVIQKNINMPGTFDSQGFLNIGFAGHQPSIGENYISTGSLYLCAAIFLPLGLPANDQFWTAKEEQWTAKKIYQ… |
| U4TQU8 | 278-376 | None |
| A0A3L7YW82 | 54-138 | None |
| R6AS04 | 123-221 | None |
| A0A7C3RAG0 | 138-235 | None |
| A0A059WXU6 | 48-146 | None |
| A0A069D2G1 | 238-336 | None |
| A0A645D730 | 45-143 | None |
| A0A843EPU0 | 163-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.