DPCstruct | MC21128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3TBD0 | 5-123 | TTLAKVFDNVDKMATNCYDKFIPVSGLSFNSLDSVNIGSDLYTLGPVAQQSISYRLGIPFQYLRRCPPEMQSYNMNHWIKREKNDEL… |
| A0A641W3P3 | 38-174 | MDTINRLLSEGRIAQDFIAPIGVSQRSKERPVISFKAEGRVQMAMPEGNFNLHGNAISQISEKMGIPAKYLRELSAGDVWQKQLCAT… |
| A0A3E4V0M3 | 54-214 | None |
| A0A854FXI4 | 11-143 | None |
| B0T7K3 | 47-191 | None |
| A0A521S9K3 | 120-248 | None |
| A0A6N2W6W5 | 48-207 | None |
| A0A840XWJ8 | 2-125 | None |
| A0A3M2ICH2 | 14-161 | None |
| F5RJJ9 | 1-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.