DPCstruct | MC21126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 185 |
|---|---|
| Mean domain length (aa) | 256 ± 69 aa |
| Standard deviation of domain lengths | 68.52 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 86.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 99.07 |
| Assigned Pfam label(s) | CL0240- CL0533- PF04387 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0RR53 | 1-206 | MNAAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSLLGTKRTLPGKHLDKIAEQMRIHNINALLVIGGFEA… |
| A0A641VQU5 | 4-241 | VKCIGILTSGGDAPGMNAAIRAVTRAAIYNGLQVKGIYRGYKGLVTGEIKEFKSQNVSNIIQLGGTILKTARCKEFTTPEGRQLAYD… |
| A0A351I961 | 121-417 | None |
| A0A287QJ91 | 11-264 | None |
| A0A287QPG2 | 52-231 | None |
| A0A2R6QFI5 | 3-190 | None |
| R5WGJ8 | 2-300 | None |
| A0A4S4DCQ2 | 326-470 | None |
| A0A3Q0JCM1 | 235-376 | None |
| A0A843WXV4 | 89-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.