DPCstruct | MC21122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 123 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.78 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0220- CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R4N4 | 153-278 | MAVPFSNTTLRVPHGFPNLLEGFAREVLRHQPKDIYGFGAKYFEELLLKREETGTEDLAQLGAKLNDRYYNNKAYCTGTCNINNAEH… |
| A0A452FXB5 | 1-135 | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFENLLEKREKTSFDPAEWGAKVDDRFYNNHAFKEQESPEKHEPGK… |
| C1C3T4 | 1-96 | None |
| A0A6P8PXF3 | 1-114 | None |
| A0A6F9DST7 | 3-125 | None |
| G3P356 | 1-88 | None |
| A0A5K3FFT9 | 1-119 | None |
| A0A4W6D048 | 1-130 | None |
| A0A0V0J8R7 | 1-147 | None |
| A0A3P9H5P3 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.