DPCstruct | MC21121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 13.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.51 |
| Pfam Score | 76.67 |
| Assigned Pfam label(s) | CL0179- PF09360- PF10660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5SKX3 | 3-71 | KGGHCNLSVKKNESKVVDSIDMEDLGDKASFCRCWRSAKFPYCDGTHGKHNTTTGDNVGPLVIKKKELS |
| A0A452FWQ2 | 31-113 | VGYLAYKRFYVKDHRNKSMVNPHIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPLCDGSHTKHNEETGDNVGPLIIKKKDT |
| A0A183BDJ6 | 19-102 | None |
| A0A4W5L680 | 125-211 | None |
| A0A7S3C085 | 7-79 | None |
| A0A5F4W0P6 | 53-127 | None |
| A0A673W7U9 | 29-123 | None |
| A0A7S4P8M5 | 35-114 | None |
| A0A498N8E5 | 141-221 | None |
| A0A2K1IJA8 | 197-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.