DPCstruct | MC21120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 123 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 50.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A452FNW1 | 14-138 | RNVDARGVPEIPWLINAQKLFEWANEVRIDPNNPECSDLMEFITYIKHKGQDIPKYFRLEQLQDEFNFASEEEMKKSKRFQLLQLRS… |
| F7HD02 | 23-139 | GIPWLINEQKLFEWANEVRIDPNNPEYSDLMEFVMYMRLKGQDIPKYFRLEQLQDEFNFVSEEEMAKSKRFQLLQLRNAGQLDNFLL… |
| A0A2R2MNH3 | 101-226 | None |
| G1NTL1 | 339-461 | None |
| A0A7M4F7S3 | 8-131 | None |
| A0A3B4AM41 | 3-117 | None |
| A0A7R9H104 | 211-345 | None |
| A0A821Y9J5 | 516-642 | None |
| A0A6J0D025 | 161-273 | None |
| A0A6A4TKA3 | 642-773 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.