DPCstruct | MC2112
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 279 ± 54 aa |
| Standard deviation of domain lengths | 53.67 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6F8M8 | 1-135 | MCVVCALERVHVMRCAVHRIVPLKGYDVDTFDLRAAYNSLVPKPGQAPKKTNPWCSLCPNPAFFGCGALQAVNKFQEPIDASSQDAI… |
| A0A5N6ZG39 | 1-233 | MTLPALPSPAAIDGEHPRNPSTRIIHTSLAHPVTFDYEPPKDGSHPCQWCHNFTYGLLGLGKRTVEVLDFGNGRYIEVSGGHVAEGH… |
| E4ZPX9 | 564-854 | None |
| A0A370TXB2 | 274-569 | None |
| M2TJG1 | 43-422 | None |
| C4JXA2 | 241-460 | None |
| A0A6A6G1T3 | 74-365 | None |
| A0A0D2IT63 | 25-308 | None |
| A0A319CSB8 | 55-364 | None |
| M2N8F0 | 322-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.