DPCstruct | MC21116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 126 ± 17 aa |
| Standard deviation of domain lengths | 16.80 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF16861- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0SZA0 | 1-151 | MVQRLIVLLICKLYESSLFKDLYVLPFPGDESISFGCALHEYYKVHKFKIFPRSKQHGYFGDKLNSPTDNEIEKIFTGYNIKKEKDI… |
| A0A2G9P6M1 | 325-440 | KNIWIQPAASDAGTSIGTANYIFNSILGNKRNYEMTNAFLGPEFSTQEIKNFFEENKIKYSEFKNEKEIIKTTAKLIYENKIVSWFQ… |
| A0A419RVW1 | 1-120 | None |
| A0A6C1BXJ0 | 1-111 | None |
| R7QIX4 | 22-151 | None |
| A0A836QTB4 | 157-276 | None |
| A0A2H0NFW3 | 31-152 | None |
| A0A7W8XL03 | 170-302 | None |
| A0A1F3W7V9 | 91-213 | None |
| A0A1V1PFF9 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.