DPCstruct | MC21114
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0334 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5PIG0 | 3-117 | DIQNQQDNRNINIQRVGVKRVYLPLQILEKTGTYQTVTAEISLCADLAKDLRGTHMSRFMEILHRWSKEKISSREIKIILQEVLNKL… |
| A0A7C3MUD4 | 59-175 | CMEDVTQQTISRDVTVQRVGAKDLHSPVPVRRRKGRQQAVLGAAVLAARRPEQEHGPHMSRLVDLLYHGSPGSEGIRQIRSNASPKL… |
| F8XTV7 | 1-127 | None |
| A0A1I7YJG3 | 697-820 | None |
| Q8TZZ2 | 4-110 | None |
| A0A522PFV0 | 165-294 | None |
| A0A653A326 | 1-99 | None |
| I0I6H9 | 69-190 | None |
| A0A4P5VV02 | 10-125 | None |
| D9PLG7 | 4-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.