DPCstruct | MC21111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 359 ± 59 aa |
| Standard deviation of domain lengths | 58.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1K903 | 1-278 | MLPNADPTYLQAEADKLANKTENDLKTFLDNALETGDYPTMESYLKNRKDNEVIDRYTDGFTLDAFLKEFPDPEKYFSDPNRTYGPS… |
| A0A5M8Q0E8 | 35-467 | AASTPRLPRSPASPSFFALPSSEHSKSPSEAAAEKPDLRELNAALVALAAVFPDVKPEVFREMLSTFAEESRLHVVAEQLLKHKAKW… |
| A0A0D6EL35 | 119-475 | None |
| A0A6P4U0N9 | 220-629 | None |
| A0A1Y1KAY9 | 117-437 | None |
| A0A834K5A8 | 434-868 | None |
| A0A7S2M4S6 | 6-313 | None |
| A0A7R8Z9X3 | 417-802 | None |
| A0A0N1NY55 | 175-578 | None |
| A0A0K6GDL1 | 181-524 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.