DPCstruct | MC21110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 303 ± 47 aa |
| Standard deviation of domain lengths | 46.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6IY53 | 151-439 | ARMTSHSTLKATFASRAETATHPLTTYLLRLMDLKASNLCLSADVPTARELLYLADKVGPSIVVLKTHHDIVAGWDFNPQTGTGAKL… |
| A0A5M8PTQ7 | 1-293 | MSTPPRSSLTQPFTTRADLPNTHPLTSYLLQLITIKRSNLCVSADVTSTSALLKLAEEVGDSICVLKTHADIIDHFSDRTIMGLQEI… |
| A0A6A6U370 | 1-329 | None |
| A0A183SEM6 | 166-420 | None |
| E5A7A6 | 207-529 | None |
| A0A0D2XV97 | 1-233 | None |
| A0A084S0B5 | 1-287 | None |
| A0A139IUW8 | 758-1063 | None |
| A0A397GX26 | 17-382 | None |
| A0A0C4E7L1 | 3-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.