DPCstruct | MC21107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 17.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 49.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1GW17 | 5-144 | LRRGTSFLFAGTKSPLADSATTTASENTLFTRVDPSIDGEDCDRDCVSCTLRYPSKFDIDTGDKLYGNVKGWATHVLIATGKTDWVR… |
| A0A5M8PNK4 | 5-162 | LQKMNSSIASALRRGAAFLTPNASSDSLPKLDNSPFATAPSGQLFPQVDPAIDGQDCFDDCATCTTHLPAKWSIDEDKKLYGDVKGW… |
| A0A395J5H9 | 23-156 | None |
| A0A842YZE9 | 1-119 | None |
| A0A167SEC7 | 1-125 | None |
| A0A1Y2TRB5 | 672-829 | None |
| A0A366NKN6 | 2-106 | None |
| A0A1Z5TL20 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.