DPCstruct | MC21106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 159 ± 15 aa |
| Standard deviation of domain lengths | 14.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 69.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.77 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 33.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R0NYL3 | 1-157 | MSSAARSVVGLLMAAIAGPLGAEPPPGSADHALAAARAAYGPAPESEPCTAQEEAAIITGEIVVCRRRATEEHRLRGADEARRRHAA… |
| A0A6I4TDR2 | 1-167 | MSRRTGFGNAHAFMGAIALVVAPAASGAQDSPPPVNAEQAMERAREVYGPPDTRARPECPPPKPGDEIVVCGQTEDMSKYRVQSSGD… |
| A0A074M021 | 18-198 | None |
| A0A2E2IV60 | 7-136 | None |
| A0A7T0R3B2 | 1-160 | None |
| A0A6I4V844 | 16-166 | None |
| A0A2M7HGB8 | 1-152 | None |
| A0A852XQS3 | 11-164 | None |
| A0A6I4SJE7 | 5-179 | None |
| A0A419R3P6 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.