DPCstruct | MC21105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4BN83 | 1-83 | MALEPETPQRRVEYTCPMHPEVVQDQPGDCPKCGMALEPRTASAAEGPSAEFVAFTRRLWVAVPPTAVLLLITMSDMLPGVHF |
| A0A1G6C7A3 | 6-74 | QQSRPKSTQFTCPMHPEIVKDKPGDCPICGMDLVPMKPDVSAEEKNYKMLSKKFWIAVTFTLPIFLIAM |
| A0A037UQG4 | 78-157 | None |
| A0A7G3ZXK8 | 29-112 | None |
| A0A6L3ZZF9 | 61-146 | None |
| A0A497D4N2 | 60-159 | None |
| A0A1J4SP80 | 44-151 | None |
| A0A0F9CYC2 | 120-202 | None |
| A0A090QBT6 | 124-200 | None |
| A0A0G1MKW7 | 31-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.