DPCstruct | MC21101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 200 ± 16 aa |
| Standard deviation of domain lengths | 16.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7HJR3 | 180-374 | DPATVPGVVAALVAASEIPDRDDDSRLRGLWLDIVAEGIVERYGPWVTGWRWSVGEGDFDGGPVGSWCCFGHSVSTPEATTAAIVAA… |
| A0A561WXF9 | 45-252 | PDVVRSLAPAASVPTRPPGRSGQDDVYQWGQRVGTRWADEMSVALVRHYGRWASGWRWGVGEADVGGGPVHAWCCPADSMGSPEQTL… |
| A0A1C4V6E5 | 20-219 | None |
| A0A1Q4W5W2 | 24-214 | None |
| W7IXK7 | 77-274 | None |
| L1L6Z1 | 1-174 | None |
| A0A1M5Z1D4 | 57-275 | None |
| A0A7K1FJ72 | 2-206 | None |
| A0A7Y6PYM0 | 9-186 | None |
| A0A286CUC0 | 4-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.